Analysis of genetic variability within the immunodominant epitopes of envelope gp41 from human immunodeficiency virus type 1 (HIV-1) group M and its impact on HIV-1 antibody detection

Citation
J. Dorn et al., Analysis of genetic variability within the immunodominant epitopes of envelope gp41 from human immunodeficiency virus type 1 (HIV-1) group M and its impact on HIV-1 antibody detection, J CLIN MICR, 38(2), 2000, pp. 773-780
Citations number
27
Language
INGLESE
art.tipo
Article
Categorie Soggetti
Clinical Immunolgy & Infectious Disease",Microbiology
Journal title
JOURNAL OF CLINICAL MICROBIOLOGY
ISSN journal
0095-1137 → ACNP
Volume
38
Issue
2
Year of publication
2000
Pages
773 - 780
Database
ISI
SICI code
0095-1137(200002)38:2<773:AOGVWT>2.0.ZU;2-N
Abstract
The serodiagnosis of human immunodeficiency virus type I (HIV I) infection primarily relies on the detection of antibodies, most of which are directed against the immunodominant regions (IDR) of HIV-l structural proteins. Amo ng these, the N-terminal region of gp41 contains cluster I (amino acids [aa ] 580 to 623), comprising the cytotoxic T-lymphocyte epitope (AVERYLKDQQLL) and the cysteine loop (CSGKLIC), and cluster II (aa 646 to 682), comprisin g an ectodomain region (ELDKWA). To delineate the epitope diversity within clusters I and II and to determine whether the diversity affects serologic detection by U.S. Food and Drug Administration (FDA)-licensed enzyme immuno assay (EIA) kits, gp41 Env sequences from 237 seropositive persons infected with HIV-1 group RI, subtypes A (n = 42), B (n = 62), B' (n = 13), C (rt = 38), D (n = 41), E (n = 18), F (n = 27), and G (n = 6), and 6 HIV-l infect ed but persistently seronegative (HIPS) persons were analyzed. While all ID R were highly conserved among both seropositive and HIPS persons, minor ami no acid substitutions (<20% for any one residue, mostly conservative) were observed for all subtypes, except for B', in comparison with the consensus sequence for each subtype. Most importantly, none of the observed substitut ions among the group M plasma specimens affected antibody detection, since ail specimens (II = 152) tested positive,vith all five FDA-licensed EIA kit s. Furthermore, all specimens reacted with a group hi consensus gp41 peptid e (WGIKQLQARVLAVERYLKDQQLLGIWGCSGKLICTTAVPWNASW), and high degrees of cross reactivity (>80%) were observed with an HIV-1 group N peptide, an HIV-1 gro up O peptide, and a peptide derived from the homologous region of gp41 from simian immunodeficiency virus from chimpanzee (SIVcpz). Taken together, th ese data indicate that the minor substitutions observed within the IDR of g p ll of HIV-1 group M subtypes do not affect antibody recognition and that all HIV-1-seropositive specimens containing the observed substitutions reac t with the FDA-licensed EIA kits regardless of viral genotype and geographi c origin.